PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn272111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 1804aa    MW: 196662 Da    PI: 6.4917
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn272111genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.14.1e-2914831533252
      RWP-RK    2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52  
                  ek+isl++l++yFs+++kdAAk+Lgvc+T+LKriCRq+GI RWP+Rkik++
  Achn272111 1483 EKSISLQVLRQYFSGSLKDAAKSLGVCPTTLKRICRQHGITRWPSRKIKKV 1533
                  89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF542363.45E-2310106IPR029071Ubiquitin-related domain
Gene3DG3DSA:3.10.20.902.3E-2116100No hitNo description
PROSITE profilePS5005320.2181887IPR000626Ubiquitin domain
SMARTSM002133.7E-191889IPR000626Ubiquitin domain
PfamPF002401.8E-192087IPR000626Ubiquitin domain
SMARTSM007271.6148195IPR006636Heat shock chaperonin-binding
SMARTSM007274.1E-9199238IPR006636Heat shock chaperonin-binding
SMARTSM007271.6366407IPR006636Heat shock chaperonin-binding
SMARTSM007271.9E-6411446IPR006636Heat shock chaperonin-binding
PfamPF139123.6E-6574598IPR007087Zinc finger, C2H2
SMARTSM003550.018574596IPR015880Zinc finger, C2H2-like
PROSITE profilePS501579.66574601IPR007087Zinc finger, C2H2
SuperFamilySSF576676.19E-6575596No hitNo description
PROSITE patternPS000280576596IPR007087Zinc finger, C2H2
SuperFamilySSF576676.19E-6664691No hitNo description
PfamPF139121.4E-8669692IPR007087Zinc finger, C2H2
SMARTSM003550.47669691IPR015880Zinc finger, C2H2-like
PROSITE profilePS5015710.242669696IPR007087Zinc finger, C2H2
PROSITE patternPS000280671691IPR007087Zinc finger, C2H2
PfamPF139121.1E-11730754IPR007087Zinc finger, C2H2
SMARTSM003550.76730752IPR015880Zinc finger, C2H2-like
PROSITE profilePS501579.411730759IPR007087Zinc finger, C2H2
PROSITE patternPS000280732752IPR007087Zinc finger, C2H2
PROSITE profilePS5151917.42714721553IPR003035RWP-RK domain
PfamPF020428.7E-2614861533IPR003035RWP-RK domain
SuperFamilySSF542771.72E-2217021791No hitNo description
Gene3DG3DSA:3.10.20.2409.8E-2417031786No hitNo description
SMARTSM006669.4E-2417051788IPR000270PB1 domain
PROSITE profilePS5174521.05417051788IPR000270PB1 domain
PfamPF005641.1E-1617061785IPR000270PB1 domain
CDDcd064076.06E-3917061787No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1804 aa     Download sequence    Send to blast
MGADGEAVDS SLGGGEEVTL NIRCSNGSKF TVRTSLEATV EAFKAVLAQN CDVPADQQRL  60
IYKGRILKND QTLASYGLQA DHTVHMVRGF APAASTPPAA TATVGNPNPT PGIAQGVGSN  120
EGGGVGGVGL GASLLPGLGF NALGGSGAPG LFGAGLPEFE QVQQQLTQNP NMMREIMNMP  180
AIQSLMNNPD LMRSMIMSNP QMRDIIDQNP ELAHVLNDPG ILRQTLEAAR NPELMREMMR  240
NTDRAMSNIE SSPEGFNMLR RMYENVQEPF LNATTMAGGT GSDTGANPFA SLLGNQGGGA  300
QSGNVSNNSS TTGSETNTGS TVPNTNPLPN PWGGTGGGSQ ANTTVRSNPT GEARAPGIGG  360
LGGLGHPELE RMFGMADPSA MNQLMQNPAV SQMMQSLLSN PQYMNQFLGL NPQLRSMLDL  420
NPQLREMLQN PEILRQLTSP ETMQQMMAVQ QALLSQLNRQ QSTQVANPKL VSCRGTAQTG  480
GTQVTAIVMT DHSDANNNQN QSGGDTTHLQ LSAPPAQEIF DFRIPKYPKN PRKKRTKLSK  540
MDDSIGPTLG STSGAPARPK SGKKPDPSAP KITRPCSECG KKFWSWKALF GHMRCHPERQ  600
WRGINPPPNL RQPETSVEAA MTEADHEVAA CLLMLANYAP VTTTRTDHGL SESDIVAAGG  660
GGGDVNCKFE CSSCKKVFGS HQALGGHRAS HKNVKGCFAM TRSESEEVDP SGGYWGDPGD  720
EEKMMMVLGH KCSVCLRVFS SGQALGGHKR CHWERGDEPS ISLTQGLSSL ATREGCGLDL  780
NLPAPIEDDS LSCYSSSSGM ALDLRSYYSS SLKKKIESRG FVGNLWYGLK SDKLKFNSNS  840
DAKSEESVKY RTRVIEVKTQ FCIFMKDGSF TPNTMLETLS DNNMAFNLMD ELLYDGYWLE  900
TTEGPNFWQY GPSTSDTLNF SSYSGPTSEP NTVHLNPNPH QKSHQERAEI LDLGNNLPLF  960
YPQMDELVGS QTQNREVILA DASSFQPENF LVESTETNRR LWIPPSEDPS RSYSVKKRLM  1020
QAIEHLRQST SDRDVLIQIW VPIKRGGKQF LTTNNQPFSV NSNCKKLADY RNVSMSYQFA  1080
AEENSKDFVG LPGRVFLKRL PEWTPDVQFF RREEYPRVRH AQQLDVRGSL ALPVFERGSG  1140
TCLGVVEIVT TSQQANYGPE LESVCKALEA CDDSYQAALT EIQEVLKSVC DTHGLPLAQT  1200
WAPCIQHGKA GCSHSSENYA SCVSTVDSAW YVRNRQVLDF HEACSEHHLL RGEGVAGGAF  1260
MTNRPCFSND ITALSKIEYP LSHHARMFGL RAAVAIRLRS IYAQSADFVL EFFLTSDFQN  1320
AEGHIPVLSS LSSAIHQVCL SLRLVTDQEL AEETAFQEKV IVAPSDGSLD EDCAQKLGSS  1380
LSKESSQKES SWIADMMEAQ RKGKAISVSS GYQKEEPKEE SKETWDIDGT NLYHGNAFSD  1440
HKQIYQDSGP KGNTESGGDF SSVSRHSLPG VRKAGERRRT KSEKSISLQV LRQYFSGSLK  1500
DAAKSLGVCP TTLKRICRQH GITRWPSRKI KKVGHSLKKL QLIIDSVQGV DGSFQLSSFY  1560
SNFPDLSSPN LPGTSPVSTS NINDQLKQFN TKPESSLLSP VTTTSKSPSS SCSHSSSSSF  1620
YCSTETKQPP ATVHALGGGD SSLEEQPGGM LKRAHSDAEL YDAGQEETKL LVRSQSHKLF  1680
SELPSSDALP PPPKVGGQVS RDGSGFRVKA TFGEEKIRLS IQQNWGFGDL QQEIVKRFNI  1740
DENSKINLKY LDDDSEWVLL TCDADLEECI DIHRLSRIRT VKLSVYQAFN PNLGSSFGSS  1800
GPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010645880.10.0PREDICTED: protein NLP2-like
RefseqXP_010645886.10.0PREDICTED: protein NLP2-like
RefseqXP_010645896.10.0PREDICTED: protein NLP2-like
RefseqXP_010645900.10.0PREDICTED: protein NLP2-like
TrEMBLF6I0S70.0F6I0S7_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein